General Information

  • ID:  hor001211
  • Uniprot ID:  O46023
  • Protein name:  FLP-15
  • Gene name:  flp-15
  • Organism:  Caenorhabditis elegans
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  RGPSGPLRF
  • Length:  9
  • Propeptide:  MQFSTLIRVAVFAVLAIATLADYDDNSVGTIPVAVDLDYFSNYVKKGGPQGPLRFGKRRGPSGPLRFGKRSSFHVAPAAEDVASWYQ
  • Signal peptide:  MQFSTLIRVAVFAVLAIATLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O46023-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001211_AF2.pdbhor001211_ESM.pdb

Physical Information

Mass: 112900 Formula: C44H71N15O11
Absent amino acids: ACDEHIKMNQTVWY Common amino acids: GPR
pI: 12.5 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -80 Boman Index: -2346
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 43.33
Instability Index: 4225.56 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans